PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0755s0030.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 420aa    MW: 45696.9 Da    PI: 8.465
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0755s0030.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.92e-2467109244
                     WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                              epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  SapurV1A.0755s0030.2.p  67 LEPGRCRRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 109
                             69***************************************97 PP

2QLQ54.63.2e-191749234
                     QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34
                            +FT+aQ+ +L++Q+++yKy++a++PvPp+Ll +
  SapurV1A.0755s0030.2.p 17 PFTNAQWKELERQAMIYKYIMASVPVPPQLLIP 49
                            8*****************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.3E-111652IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.6E-131749IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.4591752IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.59666110IPR014977WRC domain
PfamPF088791.7E-2068109IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MFLLSVGGNM AASLGFPFTN AQWKELERQA MIYKYIMASV PVPPQLLIPP PKMGDGLNVR  60
FSNGADLEPG RCRRTDGKKW RCSRDVAPDQ KYCERHMHRG RPRSRKHVEL NTDHNNKKSR  120
HNPDICTEAP VTVAISNPTI NSSNSGSASH DQFVGSMPQP YIQTLDFVNK SSEKTAAFDA  180
NGAFGSTYKE PRSLGWMLKG EAGPIATNDQ QWLHLVQKEI GLATQGPFNN ASALNQNYQG  240
ESLNLNSFGE FNAREDQQSN QYSLFLDEAP RSFIDAWSND ANSRNTSSVS SDGKLPLSPL  300
SLSMESNRSI GDEMGQIQMG LRLIKPYKNQ ECGHNSSTPG GPLAEVLQLR TSNTMGANQS  360
SSIIENGDSI SPPATTVSSP SGVLQKKLAS FSDSSGNSSP THVSSRTKPG TAMLWLNQG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318461.10.0hypothetical protein POPTR_0012s02950g
TrEMBLB9I2260.0B9I226_POPTR; Uncharacterized protein
STRINGPOPTR_0012s02950.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.17e-34growth-regulating factor 7